Structure of PDB 4aao Chain B

Receptor sequence

>4aaoB (length=305) Species: 243231 (Geobacter sulfurreducens PCA)

EDVMKRAQGLFKPIPAKPPVMKDNPASPSRVELGRMLFFDPRLSASHLIS
CNTCHNVGLGGTDILETSGPRNSPTVLNAVYNIAQFWDGRAEDLAAQAKG
PVQASVEMNNKPENLVATLKSIPGYPPLFRKAFPGQGDPVTFDNVAKAIE
VFEATLVTPDAPFDKYLKGNRKAISSTAEQGLALFLDKGCAACHSGVNMG
GTGYFPFGVREDGRYKVTSTAADKYVFRSPSLRNVAITMPYFHSGKVWKL
KDAVKIMGSAQLGISITDADADKIVTFLNTLTGAQPKVMHPVLPPNSDDT
PRPVS

3D structure

• PDB: 4aao Maca is a Second Cytochrome C Peroxidase of Geobacter Sulfurreducens.
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E107
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	C73 C76 H77 P103 N111 F115 W116 P130 S134 M137 E182 R268	C51 C54 H55 P74 N82 F86 W87 P101 S105 M108 E153 R228
BS02	HEC	B	C219 C222 H223 F234 R268 S269 P270 L272 Y281 F282 H283 M297	C190 C193 H194 F205 R228 S229 P230 L232 Y241 F242 H243 M257
BS03	CA	B	N101 T278 P280	N72 T238 P240

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0004601 peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:4aao, PDBe:4aao, PDBj:4aao
• PDBsum: 4aao
• PubMed: 22417533
• UniProt: Q74FY6