Structure of PDB 4aa6 Chain B

Receptor sequence
>4aa6B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence]
TRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHDYMCPATNQCTIDKN
RRKSCQACRLRKCYEVGMMK
3D structure
PDB4aa6 The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side-chain conformation.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B E203 G204 A207 R211 R234 K235 Q238 R241 E22 G23 A26 R30 R52 K53 Q56 R59
BS02 dna B Y195 H196 Y197 K206 K210 Y14 H15 Y16 K25 K29
BS03 ZN B C185 C188 C202 C205 C4 C7 C21 C24
BS04 ZN B C221 C227 C237 C240 C39 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4aa6, PDBe:4aa6, PDBj:4aa6
PDBsum4aa6
PubMed7735836
UniProtP03372|ESR1_HUMAN Estrogen receptor (Gene Name=ESR1)

[Back to BioLiP]