Structure of PDB 4a9i Chain B |
>4a9iB (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
VPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLE KIFLQKVASMPQEEQE |
|
PDB | 4a9i Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery. |
Chain | B |
Resolution | 2.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
P9I |
B |
W97 P98 L108 N156 |
W27 P28 L38 N86 |
|
|
|