Structure of PDB 4a4q Chain B |
>4a4qB (length=99) Species: 12721 (Human immunodeficiency virus) [Search protein sequence] |
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGI GGFIKVRQYDQIPIEICGHKAIGTVLVGPTPTNVIGRNLLTQIGCTLNF |
|
PDB | 4a4q Synthesis, X-Ray Analysis, and Biological Evaluation of a New Class of Stereopure Lactam-Based HIV-1 Protease Inhibitors. |
Chain | B |
Resolution | 1.8 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D125 T126 G127 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
3.4.23.16: HIV-1 retropepsin. |
|
|
|
|