Structure of PDB 3zzl Chain B

Receptor sequence
>3zzlB (length=70) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence]
SNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVK
IRGKAIIQTSYGTLDTEKDE
3D structure
PDB3zzl How to Change the Oligomeric State of a Circular Protein Assembly: Switch from 11-Subunit to 12-Subunit Trap Suggests a General Mechanism
ChainB
Resolution1.67 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TRP B G23 Q47 T49 T52 V55 G17 Q41 T43 T46 V49
BS02 TRP B S7 R26 T49 E50 S1 R20 T43 E44
BS03 TRP B T25 R26 G27 T30 S53 T19 R20 G21 T24 S47
Gene Ontology
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3zzl, PDBe:3zzl, PDBj:3zzl
PDBsum3zzl
PubMed21984911
UniProtQ9KCC6|MTRB_HALH5 Transcription attenuation protein MtrB (Gene Name=mtrB)

[Back to BioLiP]