Structure of PDB 3zet Chain B

Receptor sequence

>3zetB (length=337) Species: 909946 (Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74)

MRVLGIETSCDETGIAIYDDKKGLLANQLYSQVKLHADYGGVVPELASRD
HVRKTVPLIQAALKEAGLTASDIDAVAYTAGPGLVGALLVGATVGRSLAF
AWNVPAIPVHHMEGHLLAPMLEDNPPEFPFVALLVSGGHTQLISVTGIGQ
YELLGESIDDAAGEAFDKTAKLLGLDYPGGPMLSKMASQGTAGRFVFPRP
MTDRPGLDFSFSGLKTFAANTIRSNGGDEQTRADIARAFEDAVVDTLMIK
CKRALESTGFKRLVMAGGVSANRTLRAKLAEMMQKRRGEVFYARPEFCTD
NGAMIAYAGMVRFKAGVTADLGVTVRPRWPLAELPAA

3D structure

• PDB: 3zet Crystal Structure of the Dimer of Two Essential Salmonella Typhimurium Proteins, Ygjd & Yeaz and Calorimetric Evidence for the Formation of a Ternary Ygjd-Yeaz-Yjee Complex.
• Chain: B
• Resolution: 2.31 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.234: N(6)-L-threonylcarbamoyladenine synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AMP	B	H115 S136 G137 G163 F166 D167 P181 G267 G268 N272	H115 S136 G137 G163 F166 D167 P181 G267 G268 N272

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0005506 iron ion binding
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0046872 metal ion binding
• GO:0061711 N(6)-L-threonylcarbamoyladenine synthase activity

Biological Process

• GO:0002949 tRNA threonylcarbamoyladenosine modification
• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0070525 tRNA threonylcarbamoyladenosine metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3zet, PDBe:3zet, PDBj:3zet
• PDBsum: 3zet
• PubMed: 23471679
• UniProt: E8XBD7