Structure of PDB 3x39 Chain B |
>3x39B (length=82) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
EDPEVLFKNKGCVACHAIDTKMVGPAYKDVAAKFAGQAGAEAELAQRIKN GSQGVWGPIPMPPNAVSDDEAQTLAKWVLSQK |
|
PDB | 3x39 Domain-Swapped Dimer of Pseudomonas aeruginosa Cytochrome c551: Structural Insights into Domain Swapping of Cytochrome c Family Proteins |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEC |
B |
C12 C15 H16 |
C12 C15 H16 |
|
|
|
|