Structure of PDB 3x1l Chain B

Receptor sequence

>3x1lB (length=319) Species: 186497 (Pyrococcus furiosus DSM 3638)

MIEVTFTPYDVLLFRESRPFDAGSESVARSIIPLPQTVAGAIRTLLFYKG
LKNCVGVGEEEPEFTLVGIAIGTRIYPLPFNIIKSEKFYKVVNPGRFLGK
LILPPKGKYKSGYVTESILEKYLKGELKEVEENKVIRIEKEKRIGIKLSR
EKKVVEEGMLYTVEFLRIEKIYAWIEDPGCGIKDILSSYEFLTLGGESRV
AFVEVDDKTPDIFNRELGSTKKALFYFSTPTIGKVGEIVQELEKRLNAKI
DDYLLVSSRPTAISGWDMHEKKPKGTKFAIPPGSVLFVEFKEEVEVPPYI
KLGKLKKLGYGLALGGIWE

3D structure

• PDB: 3x1l Crystal structure of the CRISPR-Cas RNA silencing Cmr complex bound to a target analog.
• Chain: B
• Resolution: 2.096 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R15 S17 F20 A22 Q36 T37 G40 A41 R43 T44 F47 Y48 V55 I147 G148 I149 K150 L151 K156 L163 Y164 T196 G198 G199 E200 S201 S267 G268 W269 M271 P276 K277	R15 S17 F20 A22 Q36 T37 G40 A41 R43 T44 F47 Y48 V55 I144 G145 I146 K147 L148 K153 L160 Y161 T193 G195 G196 E197 S198 S264 G265 W266 M268 P273 K274
BS02	dna	B	V158 E159 E160	V155 E156 E157

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0051607 defense response to virus

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3x1l, PDBe:3x1l, PDBj:3x1l
• PDBsum: 3x1l
• PubMed: 25921071
• UniProt: Q8U1S7|CMR3_PYRFU CRISPR system Cmr subunit Cmr3 (Gene Name=cmr3)