Structure of PDB 3wxy Chain B

Receptor sequence

>3wxyB (length=376) Species: 5062 (Aspergillus oryzae)

SVSIVGIASRCAPHKLGADELEAIARRHYSSTPSLEKMLEINRKTRIDHR
YSVFSSDHEHWHRPTIPSFSECDSLFKEYGIPLASAASARAIQDWGGVPD
EITHLVAVTCTNTAHPGFDSVLCRKLGLKCNVRRVLLHGIGCGGGISAMR
VAHELLLGSTQQGVPARALIVACEVPTVFARSELDIMDKTQDVNVAMCLF
GDCAAALVLSNGIGHKASEQRPIWNILNCEPTQFDGTEDIAHFNVHDKGY
HAIIDKRIPQLTGKCVPAGFQSLISSTPSLALEEKNYVPSNYGWAVHPGG
YAVLVAAQDALGLTADDLRASYDAYRDGGNTISTTIIRILEKLRDEHKHG
SNQKDKLVLAAIGHGITLETAILTRP

3D structure

• PDB: 3wxy Structural basis for the formation of acylalkylpyrones from two beta-ketoacyl units by the fungal type III polyketide synthase CsyB.
• Chain: B
• Resolution: 1.706 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C155 F213 H310 N343
• Catalytic site (residue number reindexed from 1): C142 F200 H297 N330
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	B	K50 I54 V208 I267 K269 I271 G312 G313 A315	K37 I41 V195 I254 K256 I258 G299 G300 A302

Gene Ontology

Molecular Function

• GO:0016210 naringenin-chalcone synthase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0090439 tetraketide alpha-pyrone synthase activity

Biological Process

• GO:0009058 biosynthetic process
• GO:0030639 polyketide biosynthetic process
• GO:0044550 secondary metabolite biosynthetic process

Cellular Component

• GO:0034083 type III polyketide synthase complex

External links

• PDB: RCSB:3wxy, PDBe:3wxy, PDBj:3wxy
• PDBsum: 3wxy
• PubMed: 25564614
• UniProt: Q2U852|CSYB_ASPOR Acylalkylpyrone synthase csyB (Gene Name=csyB)