Structure of PDB 3wiu Chain B

Receptor sequence

>3wiuB (length=387) Species: 69014 (Thermococcus kodakarensis KOD1)

NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKK
MPGVEKVEFDHQAVLLGKPSPAQTIPWGIERVKAPSVWSITDGSVSVIQV
AVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTI
AALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVA
DKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAA
SGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILST
YPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKIAPVGTFDDISKNT
VRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG

3D structure

• PDB: 3wiu Requirement of the insertion sequence for activation of Tk-subtilisin
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D115 H153 N264 A324
• Catalytic site (residue number reindexed from 1): D104 H142 N253 A313
• Enzyme Commision number: 3.4.21.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	Q84 D124 L164 N166 I168 V170	Q73 D113 L153 N155 I157 V159
BS02	CA	B	L205 D208 V210 D226	L194 D197 V199 D215
BS03	CA	B	D212 D214 D216 I218 D222 D225	D201 D203 D205 I207 D211 D214
BS04	CA	B	D214 D216 D222 D224	D203 D205 D211 D213
BS05	CA	B	V108 Q110 A227 E229	V97 Q99 A216 E218
BS06	CA	B	D372 L373 P375 G377 D379	D361 L362 P364 G366 D368

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0008236 serine-type peptidase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3wiu, PDBe:3wiu, PDBj:3wiu
• PDBsum: 3wiu
• UniProt: P58502|TKSU_THEKO Tk-subtilisin (Gene Name=TK1675)