Structure of PDB 3wbm Chain B |
>3wbmB (length=84) Species: 2286 (Saccharolobus shibatae) [Search protein sequence] |
TPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVEIV RNRFLPDKIEIKEIRVGSQVVSRVSTIEIAIRKK |
|
PDB | 3wbm Biochemical and structural insights into RNA binding by Ssh10b, a member of the highly conserved Sac10b protein family in Archaea. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
B |
K16 R44 |
K10 R38 |
|
|
|
|