Structure of PDB 3w76 Chain B

Receptor sequence

>3w76B (length=313) Species: 353153 (Trypanosoma cruzi strain CL Brener)

MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAP
RDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSIS
GLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTY
LQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNG
LVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCG
GVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYR
TLEEFRGRVKTIE

3D structure

• PDB: 3w76 Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-4-189
• Chain: B
• Resolution: 1.58 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K43 N67 L71 C130 N132 V133 K164 V193
• Catalytic site (residue number reindexed from 1): K44 N68 L72 C131 N133 V134 K165 V194
• Enzyme Commision number: 1.3.98.1: dihydroorotate oxidase (fumarate).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	W76	B	N67 M69 L71 P131 N194 S195	N68 M70 L72 P132 N195 S196
BS02	FMN	B	A18 A19 G20 K43 S44 Y58 N67 M69 N127 K164 N194 G221 G222 I225 C248 G249 G250 G271 T272	A19 A20 G21 K44 S45 Y59 N68 M70 N128 K165 N195 G222 G223 I226 C249 G250 G251 G272 T273

Gene Ontology

Molecular Function

• GO:0004152 dihydroorotate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
• GO:1990663 dihydroorotate dehydrogenase (fumarate) activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006222 UMP biosynthetic process
• GO:0044205 'de novo' UMP biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3w76, PDBe:3w76, PDBj:3w76
• PDBsum: 3w76
• UniProt: Q4D3W2|PYRD_TRYCC Dihydroorotate dehydrogenase (fumarate) (Gene Name=pyr4)