Structure of PDB 3w5k Chain B

Receptor sequence
>3w5kB (length=110) Species: 9606 (Homo sapiens) [Search protein sequence]
AFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTH
TGPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKH
QESGCSGCPR
3D structure
PDB3w5k Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B C156 H172 H176 C4 H20 H24
BS02 ZN B C182 H198 H202 C30 H46 H50
BS03 ZN B C210 C213 H226 H230 C56 C59 H72 H76
BS04 ZN B C238 C241 H254 C259 C84 C87 H100 C105
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019900 kinase binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0070888 E-box binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0001649 osteoblast differentiation
GO:0001707 mesoderm formation
GO:0001837 epithelial to mesenchymal transition
GO:0003180 aortic valve morphogenesis
GO:0003198 epithelial to mesenchymal transition involved in endocardial cushion formation
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007219 Notch signaling pathway
GO:0007498 mesoderm development
GO:0010631 epithelial cell migration
GO:0010718 positive regulation of epithelial to mesenchymal transition
GO:0010957 negative regulation of vitamin D biosynthetic process
GO:0030335 positive regulation of cell migration
GO:0031069 hair follicle morphogenesis
GO:0043518 negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0060021 roof of mouth development
GO:0060070 canonical Wnt signaling pathway
GO:0060536 cartilage morphogenesis
GO:0060707 trophoblast giant cell differentiation
GO:0060806 negative regulation of cell differentiation involved in embryonic placenta development
GO:0060972 left/right pattern formation
GO:0070828 heterochromatin organization
GO:1902230 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:2000810 regulation of bicellular tight junction assembly
Cellular Component
GO:0001650 fibrillar center
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005721 pericentric heterochromatin
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3w5k, PDBe:3w5k, PDBj:3w5k
PDBsum3w5k
PubMed24699649
UniProtO95863|SNAI1_HUMAN Zinc finger protein SNAI1 (Gene Name=SNAI1)

[Back to BioLiP]