Structure of PDB 3vw4 Chain B

Receptor sequence

>3vw4B (length=120) Species: 562 (Escherichia coli) [Search protein sequence]

HHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPL
SPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSAR
SLKPWEALGISRATYYRKLK

3D structure

PDB

3vw4 Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	H174 Y177	H4 Y7
BS02	dna	B	A247 R252 G253 K255 G256 S260 K261 R262 I280 S281 T284 R287	A77 R82 G83 K85 G86 S90 K91 R92 I110 S111 T114 R117
BS03	dna	B	N176 F180 R184 Y188 R189 R192 S231 Y235 K239 F240 S241 G244 F245 S246 V248 Q249 A250 R252 G253 R254 G257 T258 K261 R262 A264 V265 S268 A269 R270 R282 Y286 K290	N6 F10 R14 Y18 R19 R22 S61 Y65 K69 F70 S71 G74 F75 S76 V78 Q79 A80 R82 G83 R84 G87 T88 K91 R92 A94 V95 S98 A99 R100 R112 Y116 K120

Gene Ontology

	Biological Process
GO:0006355	regulation of DNA-templated transcription

External links