Structure of PDB 3vow Chain B

Receptor sequence

>3vowB (length=186) Species: 9606 (Homo sapiens)

IRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGV
FRNQVDSETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEV
AEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDYEDFK
YCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ

3D structure

• PDB: 3vow The APOBEC3C crystal structure and the interface for HIV-1 Vif binding.
• Chain: B
• Resolution: 2.15 Å

Enzymatic activity

• Enzyme Commision number: 3.5.4.38: single-stranded DNA cytosine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	H66 C97 C100	H62 C93 C96

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009972 cytidine deamination
• GO:0010526 retrotransposon silencing
• GO:0016554 cytidine to uridine editing
• GO:0044029 positive regulation of gene expression via chromosomal CpG island demethylation
• GO:0044355 clearance of foreign intracellular DNA
• GO:0045071 negative regulation of viral genome replication
• GO:0045087 innate immune response
• GO:0045869 negative regulation of single stranded viral RNA replication via double stranded DNA intermediate
• GO:0051607 defense response to virus
• GO:0070383 DNA cytosine deamination

Cellular Component

• GO:0000932 P-body
• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:3vow, PDBe:3vow, PDBj:3vow
• PDBsum: 3vow
• PubMed: 23001005
• UniProt: Q9NRW3|ABC3C_HUMAN DNA dC->dU-editing enzyme APOBEC-3C (Gene Name=APOBEC3C)