Structure of PDB 3vhb Chain B

Receptor sequence
>3vhbB (length=135) Species: 61 (Vitreoscilla stercoraria) [Search protein sequence]
LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAKHPEVRPLFQPKALAMT
VLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVL
GDAATDDILDAWGKAYGVIADVFIQVEADLYAQAV
3D structure
PDB3vhb Anticooperative ligand binding properties of recombinant ferric Vitreoscilla homodimeric hemoglobin: a thermodynamic, kinetic and X-ray crystallographic study.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM B L42 F43 L57 T60 H85 V90 H94 Y95 V98 F133 L41 F42 L47 T50 H75 V80 H84 Y85 V88 F123
BS02 IMD B Y29 F43 P54 L57 Y28 F42 P44 L47
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0008941 nitric oxide dioxygenase NAD(P)H activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
GO:0071949 FAD binding
Biological Process
GO:0015671 oxygen transport
GO:0046210 nitric oxide catabolic process
GO:0071500 cellular response to nitrosative stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3vhb, PDBe:3vhb, PDBj:3vhb
PDBsum3vhb
PubMed10448042
UniProtP04252|BAHG_VITST Bacterial hemoglobin (Gene Name=vhb)

[Back to BioLiP]