Structure of PDB 3vdy Chain B

Receptor sequence
>3vdyB (length=97) Species: 1423 (Bacillus subtilis) [Search protein sequence]
MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVN
CTLWRKTAENTALYCQKGSLVGVSGRIQTRNVYVTEVLADTVRFMDP
3D structure
PDB3vdy Genetic recombination in Bacillus subtilis: a division of labor between two single-strand DNA-binding proteins.
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R10 T12 A32 N34 Y48 R10 T12 A32 N34 Y48
BS02 dna B H28 W54 H28 W54
BS03 dna B T57 Y64 V100 R101 F102 T57 Y64 V92 R93 F94
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
Biological Process
GO:0006260 DNA replication
GO:0006310 DNA recombination
GO:0030420 establishment of competence for transformation
Cellular Component
GO:0005737 cytoplasm
GO:0009295 nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3vdy, PDBe:3vdy, PDBj:3vdy
PDBsum3vdy
PubMed22373918
UniProtC0SPB6|SSBB_BACSU Single-stranded DNA-binding protein B (Gene Name=ssbB)

[Back to BioLiP]