Structure of PDB 3v96 Chain B

Receptor sequence
>3v96B (length=159) Species: 9606 (Homo sapiens) [Search protein sequence]
MPKWRKTHLTYRIVNYTPDLPRDAVDSAIEKALKVWEEVTPLTFSRLYEG
EADIMISFAVKEHGDFYSFDGPGHSLAHAYPPGPGLYGDIHFDDDEKWTE
DASGTNLFLVAAHELGHSLGLFHSANTEALMYPLYNSFTELAQFRLSQDD
VNGIQSLYG
3D structure
PDB3v96 Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure.
ChainB
Resolution1.9 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H217 E218 H221 H227
Catalytic site (residue number reindexed from 1) H113 E114 H117 H123
Enzyme Commision number 3.4.24.22: stromelysin 2.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H217 H221 H227 H113 H117 H123
BS02 ZN B H167 D169 H182 H195 H63 D65 H78 H91
BS03 CA B D174 G175 G177 S179 D197 E200 D70 G71 G73 S75 D93 E96
BS04 CA B D157 G189 L190 Y191 D193 D53 G85 L86 Y87 D89
BS05 CA B D123 D198 E200 D19 D94 E96
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3v96, PDBe:3v96, PDBj:3v96
PDBsum3v96
PubMed22427646
UniProtP09238|MMP10_HUMAN Stromelysin-2 (Gene Name=MMP10)

[Back to BioLiP]