Structure of PDB 3v8e Chain B

Receptor sequence

>3v8eB (length=216) Species: 559292 (Saccharomyces cerevisiae S288C)

MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTR
DWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTW
GSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLE
KHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVIN
KVKEELKAHNINVVDK

3D structure

• PDB: 3v8e Structural and Kinetic Isotope Effect Studies of Nicotinamidase (Pnc1) from Saccharomyces cerevisiae.
• Chain: B
• Resolution: 2.71 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D8 D51 H53 S59 H94 K122 E129 A163 C167
• Catalytic site (residue number reindexed from 1): D8 D51 H53 S59 H94 K122 E129 A163 C167
• Enzyme Commision number: 3.5.1.19: nicotinamidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	D51 H53 H94 X167	D51 H53 H94 X167
BS02	MG	B	P16 G18 T21	P16 G18 T21

Gene Ontology

Molecular Function

• GO:0008270 zinc ion binding
• GO:0008936 nicotinamidase activity
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000183 rDNA heterochromatin formation
• GO:0019358 nicotinate nucleotide salvage
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0031509 subtelomeric heterochromatin formation
• GO:1904524 negative regulation of DNA amplification

Cellular Component

• GO:0000781 chromosome, telomeric region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005777 peroxisome

External links

• PDB: RCSB:3v8e, PDBe:3v8e, PDBj:3v8e
• PDBsum: 3v8e
• PubMed: 22229411
• UniProt: P53184|PNC1_YEAST Nicotinamidase (Gene Name=PNC1)