Structure of PDB 3v6h Chain B

Receptor sequence

>3v6hB (length=342) Species: 273057 (Saccharolobus solfataricus P2)

MIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFIE

3D structure

• PDB: 3v6h Replication of n(2) ,3-ethenoguanine by DNA polymerases.
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	V32 S34 G41 A220 R242 K243 S244 G246 R247 I248 T250 R331 R332 R336	V32 S34 G41 A220 R242 K243 S244 G246 R247 I248 T250 R331 R332 R336
BS02	dna	B	E106 G185 G187 I189 T190 V296 S297 R298	E106 G185 G187 I189 T190 V296 S297 R298
BS03	DCP	B	D7 F8 Y10 Y12 A44 T45 Y48 R51 A57 D105	D7 F8 Y10 Y12 A44 T45 Y48 R51 A57 D105
BS04	MG	B	D7 F8 D105	D7 F8 D105
BS05	CA	B	S103 I104	S103 I104
BS06	MG	B	D7 D105 E106	D7 D105 E106

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3v6h, PDBe:3v6h, PDBj:3v6h
• PDBsum: 3v6h
• PubMed: 22488769
• UniProt: Q97W02|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)