Structure of PDB 3v62 Chain B

Receptor sequence
>3v62B (length=255) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL
EIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSII
LLFEDTKKDRIAEYSLKLMDIDADFLGIEELQYDSTLSLPSSEFSKIVRD
LSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD
QPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFL
APKFN
3D structure
PDB3v62 Recognition of SUMO-modified PCNA requires tandem receptor motifs in Srs2.
ChainB
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B R44 V45 L47 G127 I128 E232 A233 P234 F249 A251 P252 K253 F254 R44 V45 L47 G127 I128 E232 A233 P234 F249 A251 P252 K253 F254
BS02 NEQ B G18 F19 C22 V48 G18 F19 C22 V48
BS03 NEQ B K77 C81 Y114 K77 C81 Y114
BS04 NEQ B Q153 L154 Q153 L154
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
GO:0042802 identical protein binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0000710 meiotic mismatch repair
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006273 lagging strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006298 mismatch repair
GO:0006301 postreplication repair
GO:0007064 mitotic sister chromatid cohesion
GO:0019985 translesion synthesis
GO:0030466 silent mating-type cassette heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0035753 maintenance of DNA trinucleotide repeats
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0051054 positive regulation of DNA metabolic process
GO:0070987 error-free translesion synthesis
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005657 replication fork
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3v62, PDBe:3v62, PDBj:3v62
PDBsum3v62
PubMed22382979
UniProtP15873|PCNA_YEAST Proliferating cell nuclear antigen (Gene Name=POL30)

[Back to BioLiP]