Structure of PDB 3v57 Chain B

Receptor sequence

>3v57B (length=177) Species: 35688 (Porphyridium purpureum)

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

• PDB: 3v57 pH-dependent structural conformations of B-phycoerythrin from Porphyridium cruentum
• Chain: B
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	B	M59 N72 C73 R77 R78 A81 C82 D85 L113 L120 V122 P123 S126 S127	M59 N72 C73 R77 R78 A81 C82 D85 L113 L120 V122 P123 S126 S127
BS02	PEB	B	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158
BS03	PEB	B	C50 D54 S57 G58 C61 R129 A136 Q137 F141 A146 T147 E148 R149	C50 D54 S57 G58 C61 R129 A136 Q137 F141 A146 T147 E148 R149

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:3v57, PDBe:3v57, PDBj:3v57
• PDBsum: 3v57
• PubMed: 22863205
• UniProt: P11393|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)