Structure of PDB 3v4s Chain B

Receptor sequence

>3v4sB (length=381) Species: 592021 (Bacillus anthracis str. A0248)

DMTRIILPGKTIGIIGGGQLGRMMALAAKEMGYKIAVLDPTKNSPCAQVA
DIEIVASYDDLKAIQHLAEISDVVTYEFENIDYRCLQWLEKHAYLPQGSQ
LLSKTQNRFTEKNAIEKAGLPVATYRLVQNQEQLTEAIAELSYPSVLKTT
TGGYDGKGQVVLRSEADVDEARKLANAAECILEKWVPFEKEVSVIVIRSV
SGETKVFPVAENIHVNNILHESIVPARITEELSQKAIAYAKVLADELELV
GTLAVEMFATADGEIYINELAPRPHNSGHYTQDACETSQFGQHIRAICNL
PLGETNLLKPVVMVNILGEHIEGVLRQVNRLTGCYLHLYGKEEAKAQRKM
GHVNILNDNIEVALEKAKSLHIWDHQEQLLE

3D structure

• PDB: 3v4s Elucidation of the bicarbonate binding site and insights into the carboxylation mechanism of (N(5))-carboxyaminoimidazole ribonucleotide synthase (PurK) from Bacillus anthracis.
• Chain: B
• Resolution: 2.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	B	R107 K147 Y153 D154 G155 Q158 E182 W184 V185 F187 E190 H213 N216 E255 F257 E268	R108 K148 Y154 D155 G156 Q159 E183 W185 V186 F188 E191 H214 N217 E256 F258 E269
BS02	MG	B	E255 E268	E256 E269
BS03	MG	B	T104 E110 L269	T105 E111 L270
BS04	CO3	B	R272 H274 N275	R273 H275 N276

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 20:10:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3v4s', asym_id = 'B', title = 'Elucidation of the bicarbonate binding site and ...leotide synthase (PurK) from Bacillus anthracis. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3v4s', asym_id='B', title='Elucidation of the bicarbonate binding site and ...leotide synthase (PurK) from Bacillus anthracis. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004638,0005524,0006189,0046872', uniprot = '', pdbid = '3v4s', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004638,0005524,0006189,0046872', uniprot='', pdbid='3v4s', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>