Structure of PDB 3uu1 Chain B

Receptor sequence

>3uu1B (length=339) Species: 1773 (Mycobacterium tuberculosis)

PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAP
TADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAI
VVAAAGVPVVKHGNRASGGADTLEALGVRIDLGPDLVARSLAEVGIGFCF
APRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAE
VMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAG
FGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHA
GLSEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI

3D structure

• PDB: 3uu1 The Substrate Capture Mechanism of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Provides a Mode for Inhibition.
• Chain: B
• Resolution: 1.82 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V106
• Catalytic site (residue number reindexed from 1): V82
• Enzyme Commision number: 2.4.2.18: anthranilate phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PRP	B	V106 G107 G109 G110 N117 S119 T120 K135 N138 R139 A140 G146 E252	V82 G83 G85 G86 N93 S95 T96 K111 N114 R115 A116 G118 E224
BS02	MG	B	S119 E252	S95 E224
BS03	MG	B	D251 E252	D223 E224
BS04	14B	B	N138 P180 H183 Y186 R187 A190 R194	N114 P152 H155 Y158 R159 A162 R166
BS05	14B	B	H136 G137 N138 A179 R193 G206	H112 G113 N114 A151 R165 G178

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004048 anthranilate phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0016763 pentosyltransferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0000162 tryptophan biosynthetic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005829 cytosol
• GO:0005886 plasma membrane

External links

• PDB: RCSB:3uu1, PDBe:3uu1, PDBj:3uu1
• PDBsum: 3uu1
• PubMed: 23363292
• UniProt: P9WFX5|TRPD_MYCTU Anthranilate phosphoribosyltransferase (Gene Name=trpD)