Structure of PDB 3ut5 Chain B

Receptor sequence

>3ut5B (length=432) Species: 9940 (Ovis aries)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVY
YNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL
LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETY
SIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL
RKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVATIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVK
TAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTG
EGMDEMEFTEAESNMNDLVSEYQQYQDATADE

3D structure

• PDB: 3ut5 Structural plasticity of tubulin assembly probed by vinca-domain ligands.
• Chain: B
• Resolution: 2.73 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	K176 V177 D179 P222 T223 Y224	K174 V175 D177 P220 T221 Y222
BS02	GDP	B	G10 Q11 C12 S140 G143 G144 T145 G146 E183 N206 Y224 N228	G10 Q11 C12 S138 G141 G142 T143 G144 E181 N204 Y222 N226
BS03	LOC	B	C241 A250 D251 K254 L255 N258 M259 T314 I318 K352	C239 A248 D249 K252 L253 N256 M257 T312 I316 K350

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule

External links

• PDB: RCSB:3ut5, PDBe:3ut5, PDBj:3ut5
• PDBsum: 3ut5
• PubMed: 22868758
• UniProt: D0VWY9