Structure of PDB 3upj Chain B |
>3upjB (length=97) Species: 11709 (Human immunodeficiency virus 2) [Search protein sequence] |
FSLWKRPVVTAYIEGQPVEVLLDTGADDSIVAGIELGNNYSPKIVGGIGG FINTLEYKNVEIEVLNKKVRATIMTGDTPINIFGRNILTALGMSLNL |
|
PDB | 3upj Structure-based design of novel HIV protease inhibitors: carboxamide-containing 4-hydroxycoumarins and 4-hydroxy-2-pyrones as potent nonpeptidic inhibitors. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
U03 |
B |
D25 I50 I84 |
D23 I48 I82 |
|
|
|
|