Structure of PDB 3ulg Chain B

Receptor sequence
>3ulgB (length=62) Species: 5759 (Entamoeba histolytica) [Search protein sequence]
ALFKEIDVNGDGAVSYEEVKAFVSKKRAIKNEQLLQLIFKSIDADGNGEI
DQNEFAKFYGSI
3D structure
PDB3ulg Flexibility of EF-hand motifs: Structural and thermodynamic studies of Calcium Binding Protein- 1 from Entamoeba histolytica with Pb2+, Ba2+, and Sr2+
ChainB
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BA B D10 N12 D14 A16 E21 D7 N9 D11 A13 E18
BS02 BA B D46 D48 N50 E52 E57 D43 D45 N47 E49 E54
BS03 BA B K43 D46 A47 K40 D43 A44
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0046872 metal ion binding
GO:0051015 actin filament binding
Biological Process
GO:0006909 phagocytosis
GO:0032231 regulation of actin filament bundle assembly
GO:0045859 regulation of protein kinase activity
GO:0050766 positive regulation of phagocytosis
GO:1905303 positive regulation of macropinocytosis
Cellular Component
GO:0001891 phagocytic cup
GO:0005737 cytoplasm
GO:0031143 pseudopodium
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ulg, PDBe:3ulg, PDBj:3ulg
PDBsum3ulg
PubMed22906057
UniProtP38505|CABP1_ENTH1 Calcium-binding protein 1 (Gene Name=CaBP1)

[Back to BioLiP]