Structure of PDB 3ule Chain B

Receptor sequence
>3uleB (length=236) Species: 9913 (Bos taurus) [Search protein sequence]
CDNGTGFVLLTEPPMAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGF
SLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYV
GYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINV
EGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQ
LYLERVLKGDVEKLSKFKIRIEDPPRHMVFLGGAVL
3D structure
PDB3ule Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
ChainB
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP B G14 T15 G16 F17 G160 D161 G186 R214 K217 E218 G306 M309 Y310 G4 T5 G6 F7 G37 D38 G63 R91 K94 E95 G183 M186 Y187
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051015 actin filament binding
Biological Process
GO:0010592 positive regulation of lamellipodium assembly
GO:0034314 Arp2/3 complex-mediated actin nucleation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex
GO:0005938 cell cortex
GO:0035861 site of double-strand break
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ule, PDBe:3ule, PDBj:3ule
PDBsum3ule
PubMed
UniProtA7MB62|ARP2_BOVIN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]