Structure of PDB 3ukr Chain B

Receptor sequence
>3ukrB (length=193) Species: 9913 (Bos taurus) [Search protein sequence]
GVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYA
FNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIK
VGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVL
SGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIED
3D structure
PDB3ukr Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
ChainB
Resolution2.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CKH B Y202 A203 F204 D209 L246 P247 D248 Y49 A50 F51 D56 L93 P94 D95 MOAD: ic50=12uM
PDBbind-CN: -logKd/Ki=4.92,IC50=12uM
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051015 actin filament binding
Biological Process
GO:0010592 positive regulation of lamellipodium assembly
GO:0034314 Arp2/3 complex-mediated actin nucleation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex
GO:0005938 cell cortex
GO:0035861 site of double-strand break
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ukr, PDBe:3ukr, PDBj:3ukr
PDBsum3ukr
PubMed22623398
UniProtA7MB62|ARP2_BOVIN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]