Structure of PDB 3uhv Chain B

Receptor sequence

>3uhvB (length=145)

SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYF
KRLGDVSQGMANDKLRGHSITIMYALQNFIDQLDNPDDLVCVVEKFAVNH
ITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL

3D structure

• PDB: 3uhv Cooperative macromolecular device revealed by meta-analysis of static and time-resolved structures.
• Chain: B
• Resolution: 1.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	K96 N100	K95 N99
BS02	HEM	B	Y50 F51 R53 H69 I73 F97 N100 H101 R104 I106 F111	Y49 F50 R52 H68 I72 F96 N99 H100 R103 I105 F110

Gene Ontology

Molecular Function

• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0001666 response to hypoxia
• GO:0015671 oxygen transport

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3uhv, PDBe:3uhv, PDBj:3uhv
• PDBsum: 3uhv
• PubMed: 22171006
• UniProt: P02213|GLB1_ANAIN Globin-1