Structure of PDB 3uct Chain B

Receptor sequence
>3uctB (length=72) Species: 9606 (Homo sapiens) [Search protein sequence]
LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMIN
EVDADGNGTIDFPEFLTMMARK
3D structure
PDB3uct X-ray Structures of Magnesium and Manganese Complexes with the N-Terminal Domain of Calmodulin: Insights into the Mechanism and Specificity of Metal Ion Binding to an EF-Hand.
ChainB
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN B D20 D22 D24 T26 D17 D19 D21 T23
BS02 MN B D56 D58 N60 T62 D53 D55 N57 T59
BS03 ZN B D22 D24 D19 D21
BS04 ZN B D64 E67 D61 E64
BS05 ZN B D50 E54 D47 E51
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:3uct, PDBe:3uct, PDBj:3uct
PDBsum3uct
PubMed22803592
UniProtP0DP23|CALM1_HUMAN Calmodulin-1 (Gene Name=CALM1)

[Back to BioLiP]