Structure of PDB 3u8m Chain B |
>3u8mB (length=199) Species: 6523 (Lymnaea stagnalis) [Search protein sequence] |
LDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDV VFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTP QLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREI SVDPTSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKG |
|
PDB | 3u8m Intersubunit bridge formation governs agonist efficacy at nicotinic acetylcholine alpha 4 beta 2 receptors: unique role of halogen bonding revealed. |
Chain | B |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Molecular Function |
GO:0004888 |
transmembrane signaling receptor activity |
GO:0005216 |
monoatomic ion channel activity |
GO:0005230 |
extracellular ligand-gated monoatomic ion channel activity |
GO:0005231 |
excitatory extracellular ligand-gated monoatomic ion channel activity |
GO:1904315 |
transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential |
|
|