Structure of PDB 3tu5 Chain B

Receptor sequence

>3tu5B (length=132) Species: 9606,10090

SVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTV
QLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQG
FESATFLGYFKSGLKYKKGGVASKLRKVAEQT

3D structure

• PDB: 3tu5 Structural States and dynamics of the d-loop in actin.
• Chain: B
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	G41 D42 E73 V121	G41 D42 E73 V121

Gene Ontology

Molecular Function

• GO:0003779 actin binding
• GO:0003785 actin monomer binding
• GO:0051015 actin filament binding

Biological Process

• GO:0007015 actin filament organization

External links

• PDB: RCSB:3tu5, PDBe:3tu5, PDBj:3tu5
• PDBsum: 3tu5
• PubMed: 23009842
• UniProt: P06396|GELS_HUMAN Gelsolin (Gene Name=GSN);
  P62328;
  Q5NBX1