Structure of PDB 3ts2 Chain B

Receptor sequence

>3ts2B (length=137) Species: 10090 (Mus musculus)

EPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEG
FRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGGDRCYNC
GGLDHHAKECKLPPQPKKCHFCQSINHMVASCPLKAQ

3D structure

• PDB: 3ts2 Molecular Basis for Interaction of let-7 MicroRNAs with Lin28.
• Chain: B
• Resolution: 2.01 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	R138 C139 Y140 H148 A149 P156 Q157 K159 K160 C161 H162 F163 M170 V171 K177	R96 C97 Y98 H106 A107 P114 Q115 K117 K118 C119 H120 F121 M128 V129 K135
BS02	rna	B	W46 N48 V49 R50 M51 F53 F55 D71 F73 H75 Q76 G83 F84 R85 S100 K102 E105 R122	W13 N15 V16 R17 M18 F20 F22 D38 F40 H42 Q43 G50 F51 R52 S67 K69 E72 R89
BS03	ZN	B	C139 C142 H147 C152	C97 C100 H105 C110
BS04	ZN	B	C161 C164 H169 C174	C119 C122 H127 C132

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0008270 zinc ion binding

External links

• PDB: RCSB:3ts2, PDBe:3ts2, PDBj:3ts2
• PDBsum: 3ts2
• PubMed: 22078496
• UniProt: Q8K3Y3|LN28A_MOUSE Protein lin-28 homolog A (Gene Name=Lin28a)