Structure of PDB 3tmy Chain B |
>3tmyB (length=118) Species: 2336 (Thermotoga maritima) [Search protein sequence] |
GKRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIV TMDITMPEMNGIDAIKEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDF IVKPFQPSRVVEALNKVS |
|
PDB | 3tmy Crystal structures of CheY from Thermotoga maritima do not support conventional explanations for the structural basis of enhanced thermostability. |
Chain | B |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
B |
D10 D54 T56 |
D9 D53 T55 |
|
|
|
|