Structure of PDB 3tlx Chain B

Receptor sequence
>3tlxB (length=240) Species: 5833 (Plasmodium falciparum) [Search protein sequence]
ENLENFSTIDLLNELKRRYACLSKPDGRYIFLGAPGSGKGTQSLNLKKSH
CYCHLSTGDLLREAAEKKTELGLKIKNIINEGKLVDDQMVLSLVDEKLKT
PQCKKGFILDGYPRNVKQAEDLNKLLQKNQTKLDGVFYFNVPDEVLVNRI
SGRLIHKPSGRIYHKIFNPPKVPFRDDVTNEPLIQREDDNEDVLKKRLTV
FKSETSPLISYYKNKNLLINLDATQPANDLEKKISQHIDG
3D structure
PDB3tlx Crystal Structure of PF10_0086, adenylate kinase from plasmodium falciparum
ChainB
Resolution2.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) K41 R116 R155 R188 R199
Catalytic site (residue number reindexed from 1) K39 R114 R153 R186 R197
Enzyme Commision number 2.7.4.3: adenylate kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP B P37 G38 G40 K41 G42 T43 R151 R155 I164 Y165 H166 F169 Q227 P228 A229 P35 G36 G38 K39 G40 T41 R149 R153 I162 Y163 H164 F167 Q225 P226 A227
BS02 ADP B T59 G60 L63 R64 K85 L86 V87 V92 G113 R116 Q120 R155 R199 T57 G58 L61 R62 K83 L84 V85 V90 G111 R114 Q118 R153 R197
Gene Ontology
Molecular Function
GO:0004017 adenylate kinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016776 phosphotransferase activity, phosphate group as acceptor
GO:0019205 nucleobase-containing compound kinase activity
Biological Process
GO:0006091 generation of precursor metabolites and energy
GO:0006139 nucleobase-containing compound metabolic process
GO:0016310 phosphorylation
GO:0046940 nucleoside monophosphate phosphorylation
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3tlx, PDBe:3tlx, PDBj:3tlx
PDBsum3tlx
PubMed
UniProtQ8IJV6|KAD1_PLAF7 Adenylate kinase 1 (Gene Name=AK1)

[Back to BioLiP]