Structure of PDB 3tis Chain B |
>3tisB (length=176) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
DVLHPYRDLFPQIGQRVMIDDSSVVIGDVRLADDVGIWPLVVIRGDVHYV QIGARTNIQDGSMLHVTHKSSYNPDGNPLTIGEDVTVGHKVMLHGCTIGN RVLVGMGSILLDGAIVEDDVMIGAGSLVPQNKRLESGYLYLGSPVKQIRP LSDEEKAGLRYSANNYVKWKDEYLDQ |
|
PDB | 3tis Structures of the gamma-class carbonic anhydrase homologue YrdA suggest a possible allosteric switch |
Chain | B |
Resolution | 2.3 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
V49 Q61 H70 |
Catalytic site (residue number reindexed from 1) |
V47 Q59 H68 |
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H67 H96 |
H65 H94 |
|
|
|
|