Structure of PDB 3tbg Chain B

Receptor sequence

>3tbgB (length=456) Species: 9606 (Homo sapiens) [Search protein sequence]

KLPPGPLPDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREAL
VTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRN
LGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTC
GRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVL
RFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFN
DENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQ
VRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPK
GTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRR
ACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYE
LCAVPR

3D structure

PDB

3tbg Contributions of Ionic Interactions and Protein Dynamics to Cytochrome P450 2D6 (CYP2D6) Substrate and Inhibitor Binding.

Chain

Resolution

2.1 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	T309 F436 C443
Catalytic site (residue number reindexed from 1)	T268 F395 C402
Enzyme Commision number	1.14.14.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	RTZ	B	F112 F120 L121 G212 L213 E216 Q244 F247 D301 S304	F71 F79 L80 G171 L172 E175 Q203 F206 D260 S263
BS02	RTZ	B	L73 T76 E222 I396 F483	L32 T35 E181 I355 F442
BS03	ZN	B	H258 D270 E273	H217 D229 E232
BS04	HEM	B	R101 F120 W128 R132 A305 G306 T309 V374 H376 P435 F436 S437 R441 C443 L444 G445	R60 F79 W87 R91 A264 G265 T268 V333 H335 P394 F395 S396 R400 C402 L403 G404

Gene Ontology

	Molecular Function
GO:0004497	monooxygenase activity
GO:0005506	iron ion binding
GO:0016491	oxidoreductase activity
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016712	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
GO:0020037	heme binding
GO:0046872	metal ion binding
GO:0062187	anandamide 8,9 epoxidase activity
GO:0062188	anandamide 11,12 epoxidase activity
GO:0062189	anandamide 14,15 epoxidase activity

	Biological Process
GO:0006631	fatty acid metabolic process
GO:0006805	xenobiotic metabolic process
GO:0008202	steroid metabolic process
GO:0008203	cholesterol metabolic process
GO:0008210	estrogen metabolic process
GO:0009804	coumarin metabolic process
GO:0009820	alkaloid metabolic process
GO:0009822	alkaloid catabolic process
GO:0016098	monoterpenoid metabolic process
GO:0019369	arachidonate metabolic process
GO:0033076	isoquinoline alkaloid metabolic process
GO:0042178	xenobiotic catabolic process
GO:0042572	retinol metabolic process
GO:0042759	long-chain fatty acid biosynthetic process
GO:0051100	negative regulation of binding
GO:0070989	oxidative demethylation
GO:0090350	negative regulation of cellular organofluorine metabolic process

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0043231	intracellular membrane-bounded organelle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3tbg, PDBe:3tbg, PDBj:3tbg
PDBsum	3tbg
PubMed	25555909
UniProt	P10635\|CP2D6_HUMAN Cytochrome P450 2D6 (Gene Name=CYP2D6)

[Back to BioLiP]