Structure of PDB 3t3c Chain B

Receptor sequence

>3t3cB (length=99) Species: 11686 (Human immunodeficiency virus type 1 (BRU ISOLATE))

PQISLWQRPVVTARIGGQLIEVLLDTGADDTVIEDIDLPGKWSPKMIAGI
GGFVKVRQYDQILIEFCGKKAIGSVLVGPTPANVIGRNIMSQIGCTLNF

3D structure

• PDB: 3t3c Mutations in HIV-1 gag and pol Compensate for the Loss of Viral Fitness Caused by a Highly Mutated Protease.
• Chain: B
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D25 T26 G27
• Catalytic site (residue number reindexed from 1): D25 T26 G27
• Enzyme Commision number: 2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	017	B	D25 A28 D30 V32 A82	D25 A28 D30 V32 A82	PDBbind-CN: -logKd/Ki=10.23,Ki=59pM

Gene Ontology

Molecular Function

• GO:0004190 aspartic-type endopeptidase activity

Biological Process

• GO:0006508 proteolysis

External links

• PDB: RCSB:3t3c, PDBe:3t3c, PDBj:3t3c
• PDBsum: 3t3c
• PubMed: 22644035
• UniProt: P03367|POL_HV1BR Gag-Pol polyprotein (Gene Name=gag-pol)