Structure of PDB 3sw9 Chain B

Receptor sequence

>3sw9B (length=261) Species: 9606 (Homo sapiens)

VERIVSRDIARGYERIPIPCVNAVDSEPCPSNYKYVSQNCVTSPMNIDRN
ITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPPLIFEC
NHACSCWRNCRNRVVQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEY
VGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEP
NLVPVRVFMAHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFS
CRCGSPKCRHS

3D structure

• PDB: 3sw9 MPP8 mediates the interactions between DNA methyltransferase Dnmt3a and H3K9 methyltransferase GLP/G9a.
• Chain: B
• Resolution: 3.05 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1124 Y1211
• Catalytic site (residue number reindexed from 1): Y150 Y237
• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	D1131 A1134 D1135 D1140 L1143 F1144 D1145 D1147 C1155 Y1211 R1214 I1218	D157 A160 D161 D166 L169 F170 D171 D173 C181 Y237 R240 I244
BS02	ZN	B	C1031 C1044 C1074 C1078	C57 C70 C100 C104
BS03	ZN	B	C1037 C1074 C1080 C1084	C63 C100 C106 C110
BS04	ZN	B	C1031 C1033 C1037 C1042	C57 C59 C63 C68
BS05	ZN	B	C1225 C1232	C251 C258
BS06	SFG	B	M1105 W1107 S1141 R1166 F1167 N1169 H1170 Y1211 F1215 R1226	M131 W133 S167 R192 F193 N195 H196 Y237 F241 R252	BindingDB: IC50=28400nM

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046974 histone H3K9 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:3sw9, PDBe:3sw9, PDBj:3sw9
• PDBsum: 3sw9
• PubMed: 22086334
• UniProt: Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 (Gene Name=EHMT1)