Structure of PDB 3sjl Chain B

Receptor sequence

>3sjlB (length=343) Species: 318586 (Paracoccus denitrificans PD1222)

ADDALAALGAQLFVDPALSRNATQSCATCHDPARAFTDPREGKAHGDRNT
PTLGYAALVPAFHRDANGKYKGGQFWDGRADDLKQQAGQSMLNPVEMAMP
DRAAVAARLRDDPAYRTGFEALFGKGVLDDPERAFDAAAEALAAYQATGE
FSPFDSKYDRVMRGEEKFTPLEEFGYTVFITWNCRLCHMQRKQGVAERET
FTNFEYHNIGLPVNETAREASGLGADHVDHGLLARPGIEDPAQSGRFKVP
SLRNVAVTGPYMHNGVFTDLRTAILFYNKYTSRRPEAKINPETGAPWGEP
EVARNLSLAELQSGLMLDDGRVDALVAFLETLTDRRYEPLLEE

3D structure

• PDB: 3sjl Proline 107 is a major determinant in maintaining the structure of the distal pocket and reactivity of the high-spin heme of MauG.
• Chain: B
• Resolution: 1.63 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E113
• Catalytic site (residue number reindexed from 1): E96
• Enzyme Commision number: 1.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	N66 T275 P277	N49 T258 P260
BS02	HEC	B	C31 C34 H35 R65 T67 P68 L70 Q91 F92 W93 R96 Q103 S107 E113 M114 K265	C26 C29 H30 R48 T50 P51 L53 Q74 F75 W76 R79 Q86 S90 E96 M97 K248
BS03	HEC	B	N200 C201 C204 H205 H224 I226 L228 F264 P267 L269 M279 H280 Y294	N183 C184 C187 H188 H207 I209 L211 F247 P250 L252 M262 H263 Y277

Gene Ontology

Molecular Function

• GO:0004130 cytochrome-c peroxidase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3sjl, PDBe:3sjl, PDBj:3sjl
• PDBsum: 3sjl
• PubMed: 22299652
• UniProt: Q51658|MAUG_PARDP Methylamine utilization protein MauG (Gene Name=mauG)