Structure of PDB 3shd Chain B |
>3shdB (length=150) Species: 405955 (Escherichia coli APEC O1) [Search protein sequence] |
MFKPHVTVACVVHAEGKFLVVEETINGKALWNQPAGHLEADETLVEAAAR ELWEETGISAQPQHFIRMHQWIAPDKTPFLRFLFAIELEQICPTQPHDSD IDCCRWVSAEEILQASNLRSPLVAESIRCYQSGQRYPLEMIGDFNWPFTK |
|
PDB | 3shd Structure and atypical hydrolysis mechanism of the Nudix hydrolase Orf153 (YmfB) from Escherichia coli |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
B |
E51 E55 |
E51 E55 |
|
|
|
|