Structure of PDB 3s43 Chain B |
>3s43B (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
PQITLWKRPLVTIKIGGQLKEALLDTGADDTIIEEMSLPGRWKPKMVGGI GGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPINIIGRNLLTQIGATLNF |
|
PDB | 3s43 Critical differences in HIV-1 and HIV-2 protease specificity for clinical inhibitors. |
Chain | B |
Resolution | 1.26 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
D125 T126 G127 |
Catalytic site (residue number reindexed from 1) |
D25 T26 G27 |
Enzyme Commision number |
? |
|
|
|
|