Structure of PDB 3s2r Chain B

Receptor sequence
>3s2rB (length=78) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
MRKQMVVVRAEGGGGINPEIRKNEDKVVDSVVVTELSKNITPYCRCWRSG
TFPLCDGSCVKHNKANGDNVGPLLLKKQ
3D structure
PDB3s2r Arabidopsis thaliana ChloroNEET, a Member of the New NEET Family of Human Proteins, is Involved in Development, Senescence and Iron Metabolism.
ChainB
Resolution1.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FES B C74 R75 C76 C85 D86 G87 S88 C89 P102 C44 R45 C46 C55 D56 G57 S58 C59 P72
Gene Ontology
Molecular Function
GO:0051537 2 iron, 2 sulfur cluster binding
Biological Process
GO:0010506 regulation of autophagy
Cellular Component
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3s2r, PDBe:3s2r, PDBj:3s2r
PDBsum3s2r
PubMed
UniProtQ9FLI7|NEET_ARATH CDGSH iron-sulfur domain-containing protein NEET (Gene Name=NEET)

[Back to BioLiP]