Structure of PDB 3rsh Chain B

Receptor sequence

>3rshB (length=247) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961)

MSQFMNLEGKVALVTGASRGIGKAIAELLAERGAKVIGTATSESGAQAIS
DYLGDNGKGMALNVTNPESIEAVLKAITDEFGGVDILVNNAGITRDNLLM
RMKEEEWSDIMETNLTSIFRLSKAVLRGMMKKRQGRIINVGSVVGTMGNA
GQANYAAAKAGVIGFTKSMAREVASRGVTVNTVAPGFIETDMTKLNDEQR
TATLAQVPAGRLGDPREIASAVAFLASPEAAYITGETLHVNGGMYMI

3D structure

• PDB: 3rsh Dissecting the Structural Elements for the Activation of beta-Ketoacyl-(Acyl Carrier Protein) Reductase from Vibrio cholerae.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): G20 N114 S142 Q152 Y155 K159
• Catalytic site (residue number reindexed from 1): G20 N114 S142 Q152 Y155 K159
• Enzyme Commision number: 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	B	G16 S18 R19 I21 T41 N63 V64 N90 A91 I93 V140 S142 Y155 K159 P185 G186 I188	G16 S18 R19 I21 T41 N63 V64 N90 A91 I93 V140 S142 Y155 K159 P185 G186 I188

Gene Ontology

Molecular Function

• GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0030497 fatty acid elongation

External links

• PDB: RCSB:3rsh, PDBe:3rsh, PDBj:3rsh
• PDBsum: 3rsh
• PubMed: 26553852
• UniProt: Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG (Gene Name=fabG)