Structure of PDB 3rod Chain B

Receptor sequence

>3rodB (length=259) Species: 9606 (Homo sapiens)

SGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLD
GVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAP
AAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAV
PLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSS
YYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGL
FSLVARKLS

3D structure

• PDB: 3rod Structural basis of substrate recognition in human nicotinamide N-methyltransferase.
• Chain: B
• Resolution: 2.72 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.1: nicotinamide N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	B	Y20 Y25 G63 S64 G65 T67 Y69 D85 Y86 N90 C141 D142 T163 L164 A169	Y18 Y23 G61 S62 G63 T65 Y67 D83 Y84 N88 C139 D140 T161 L162 A167	BindingDB: IC50=35300nM
BS02	NCA	B	Y20 L164 Y204 S213	Y18 L162 Y202 S211

Gene Ontology

Molecular Function

• GO:0008112 nicotinamide N-methyltransferase activity
• GO:0008168 methyltransferase activity
• GO:0030760 pyridine N-methyltransferase activity

Biological Process

• GO:0006769 nicotinamide metabolic process
• GO:0009410 response to xenobiotic stimulus
• GO:0031100 animal organ regeneration
• GO:0032259 methylation
• GO:0034356 NAD biosynthesis via nicotinamide riboside salvage pathway
• GO:0045722 positive regulation of gluconeogenesis
• GO:0090312 positive regulation of protein deacetylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3rod, PDBe:3rod, PDBj:3rod
• PDBsum: 3rod
• PubMed: 21823666
• UniProt: P40261|NNMT_HUMAN Nicotinamide N-methyltransferase (Gene Name=NNMT)