Structure of PDB 3rms Chain B |
>3rmsB (length=110) Species: 471857 (Saccharomonospora viridis DSM 43017) [Search protein sequence] |
MQRYLWQQADGKRHVYDTARHRVQAGRPFTALCGETVTPQTERGDLTAGL WFDGECPVCTIALAKALGWPVREISDLAHRFDWSPALITRLAEVLHCSFG EVVELTGARM |
|
PDB | 3rms Crystal structure of uncharacterized protein Svir_20580 from Saccharomonospora viridis |
Chain | B |
Resolution | 2.133 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H14 C33 C56 C59 |
H14 C33 C56 C59 |
|
|
|
|