Structure of PDB 3rlz Chain B

Receptor sequence

>3rlzB (length=90) Species: 9913 (Bos taurus) [Search protein sequence]

MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKE
QEVVDKVMETLDSNGDGECDFQEFMAFVAMITTACHEFFE

3D structure

PDB

3rlz The effects of CapZ peptide (TRTK12) on the protein dynamics of S100B and S100B D63N

Chain

Resolution

2.01 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	S18 E21 D23 K26 E31	S19 E22 D24 K27 E32
BS02	CA	B	D61 N63 D65 E67 E72	D62 N64 D66 E68 E73

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0019210	kinase inhibitor activity
GO:0042803	protein homodimerization activity
GO:0044548	S100 protein binding
GO:0046872	metal ion binding
GO:0048156	tau protein binding
GO:0048306	calcium-dependent protein binding
GO:0050786	RAGE receptor binding

	Biological Process
GO:0006417	regulation of translation
GO:0007155	cell adhesion
GO:0007409	axonogenesis
GO:0007611	learning or memory
GO:0008284	positive regulation of cell population proliferation
GO:0016310	phosphorylation
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045917	positive regulation of complement activation
GO:0048143	astrocyte activation
GO:0071638	negative regulation of monocyte chemotactic protein-1 production
GO:0097490	sympathetic neuron projection extension
GO:1990845	adaptive thermogenesis

External links

PDB	RCSB:3rlz, PDBe:3rlz, PDBj:3rlz
PDBsum	3rlz
PubMed
UniProt	P02638\|S100B_BOVIN Protein S100-B (Gene Name=S100B)