Structure of PDB 3rk8 Chain B

Receptor sequence

>3rk8B (length=291) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841)

TIQGSIVAIVTPMLKDGGVDWKSLEKLVEWHIEQGTNSIVAVGTTGEAST
LSMEEHTQVIKEIIRVANKRIPIIAGTGANSTREAIELTKAAKDLGADAA
LLVTPYYNKPTQEGLYQHYKAIAEAVELPLILYNVPGRTGVDLSNDTAVR
LAEIPNIVGIKDATGDVPRGKALIDALNGKMAVYSGDDETAWELMLLGAD
GNISVTANIAPKAMSEVCAVAIAKDEQQAKTLNNKIANLHNILFCESNPI
PVKWALHEMGLIDTGIRLPLTPLAEQYREPLRNALKDAGII

3D structure

• PDB: 3rk8 Crystal structure of the chloride inhibited dihydrodipicolinate synthase from Acinetobacter baumannii complexed with pyruvate at 1.8 A resolution
• Chain: B
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T44 Y107 Y133 R138 K161 I203
• Catalytic site (residue number reindexed from 1): T44 Y107 Y133 R138 K161 I203
• Enzyme Commision number: 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PYR	B	Y133 R138 K161 G186 F244 N248	Y133 R138 K161 G186 F244 N248

Gene Ontology

Molecular Function

• GO:0008840 4-hydroxy-tetrahydrodipicolinate synthase activity
• GO:0016829 lyase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009085 lysine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0019877 diaminopimelate biosynthetic process
• GO:0044281 small molecule metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3rk8, PDBe:3rk8, PDBj:3rk8
• PDBsum: 3rk8
• UniProt: D0CFC3