Structure of PDB 3rf4 Chain B

Receptor sequence

>3rf4B (length=116) Species: 53326 (Ancylostoma ceylanicum)

PMVRVATNLPDKDVPANFEERLTDLLAESMNKPRNRIAIEVLAGQRITHG
ASRNPVAVIKVESIGALSADDNIRHTQKITQFCQDTLKLPKDKVIITYFD
LQPIHVGFNGTTVAAA

3D structure

• PDB: 3rf4 Drug Repositioning and Pharmacophore Identification in the Discovery of Hookworm MIF Inhibitors.
• Chain: B
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FUN	B	P1 M2 K32 R36 I64 V106 F108	P1 M2 K32 R36 I64 V106 F108	MOAD: Ki=0.56uM
BS02	ZN	B	E20 D24	E20 D24
BS03	FUN	B	H49 I95	H49 I95	MOAD: Ki=0.56uM

Gene Ontology

Molecular Function

• GO:0005125 cytokine activity
• GO:0005126 cytokine receptor binding
• GO:0046872 metal ion binding
• GO:0050178 phenylpyruvate tautomerase activity

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0005615 extracellular space

External links

• PDB: RCSB:3rf4, PDBe:3rf4, PDBj:3rf4
• PDBsum: 3rf4
• PubMed: 21944748
• UniProt: A4GRE3